SCOPe 2.08: Domain d4yxwh1: 4yxw H:15-100

Lineage for d4yxwh1 (4yxw H:15-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
   pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns

4. Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family)

5. Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins)

6. Protein automated matches [272490] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [272491] (1 PDB entry)

8. Domain d4yxwh1: 4yxw H:15-100 [272492]
   Other proteins in same PDB: d4yxwa1, d4yxwa2, d4yxwa3, d4yxwb1, d4yxwb2, d4yxwb3, d4yxwc1, d4yxwc2, d4yxwc3, d4yxwd1, d4yxwd2, d4yxwd3, d4yxwe1, d4yxwe2, d4yxwe3, d4yxwf1, d4yxwf2, d4yxwf3, d4yxwh2, d4yxwi_
   automated match to d2v7qh2
   complexed with anp, cl, mg, na, ts6

Details for d4yxwh1

PDB Entry: 4yxw, 3.1 Å

PDB Description: bovine heart mitochondrial f1-atpase inhibited by amp-pnp and adp in the presence of thiophosphate.

PDB Compounds: (H:) ATP synthase subunit delta, mitochondrial

SCOPe Domain Sequences for d4yxwh1:

Sequence, based on SEQRES records:

>d4yxwh1 b.93.1.1 (H:15-100) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qmsftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttsk
yfvssgsvtvnadssvqllaeeavtl

Sequence, based on observed residues (ATOM records):

>d4yxwh1 b.93.1.1 (H:15-100) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qmsftfasptqvffnsanvrqvdvptqtgafgilaahvpvlrpglvvvhaedgttskyfv
ssgsvtvnadssvqllaeeavtl

Timeline for d4yxwh1:

• d4yxwh1 first appeared in SCOPe 2.05
  
• d4yxwh1 appears in SCOPe 2.07