Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) |
Family c.53.2.0: automated matches [191506] (1 protein) not a true family |
Protein automated matches [190830] (9 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83331] [272473] (3 PDB entries) |
Domain d4yf6b1: 4yf6 B:2-163 [272482] Other proteins in same PDB: d4yf6a2, d4yf6b2, d4yf6c2, d4yf6d2 automated match to d1ylka_ complexed with cl, mg, zn |
PDB Entry: 4yf6 (more details), 3 Å
SCOPe Domain Sequences for d4yf6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yf6b1 c.53.2.0 (B:2-163) automated matches {Mycobacterium tuberculosis [TaxId: 83331]} tvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnagc vvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesyp davedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp
Timeline for d4yf6b1: