Lineage for d4q1hc_ (4q1h C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1836183Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1836184Protein automated matches [190246] (49 species)
    not a true protein
  7. 1836213Species Bacillus subtilis [TaxId:224308] [272349] (5 PDB entries)
  8. 1836219Domain d4q1hc_: 4q1h C: [272350]
    automated match to d2q34a_
    complexed with epe, gol, na

Details for d4q1hc_

PDB Entry: 4q1h (more details), 1.93 Å

PDB Description: structure and mechanism of a dehydratase/decarboxylase enzyme couple involved in polyketide beta-branching
PDB Compounds: (C:) Polyketide biosynthesis enoyl-CoA isomerase PksI

SCOPe Domain Sequences for d4q1hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q1hc_ c.14.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 224308]}
qgpmthsvvelieiesaiiqvkmqdrthknafsqeltddliqafeyirqnpkykaviltg
ydnyfasggtqegllriqqgltkftddnlyslaldceipviaamqghgigggfvmglfad
ivilsresvytanfmkygftpgmgatfivpkklgfslaqeillnagsyrgadlekrgvpf
kvlpraevldyavelaqelaekprnslvtlkdhlvaplrdqlprvieqelmmhe

SCOPe Domain Coordinates for d4q1hc_:

Click to download the PDB-style file with coordinates for d4q1hc_.
(The format of our PDB-style files is described here.)

Timeline for d4q1hc_: