Class b: All beta proteins [48724] (176 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species Homo sapiens, [TaxId:9606] [272119] (5 PDB entries) |
Domain d5afhc_: 5afh C: [272166] automated match to d4uxua_ complexed with l0b |
PDB Entry: 5afh (more details), 2.4 Å
SCOPe Domain Sequences for d5afhc_:
Sequence, based on SEQRES records: (download)
>d5afhc_ b.96.1.0 (C:) automated matches {Homo sapiens, [TaxId: 9606]} gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr serfyecckepypdvtftvtfrkkg
>d5afhc_ b.96.1.0 (C:) automated matches {Homo sapiens, [TaxId: 9606]} gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvdvvfwlqmswtd hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs erfyecckepypdvtftvtfrkkg
Timeline for d5afhc_:
View in 3D Domains from other chains: (mouse over for more information) d5afha_, d5afhb_, d5afhd_, d5afhe_ |