SCOPe 2.06: Domain d1a18a_: 1a18 A:

Lineage for d1a18a_ (1a18 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50857] (21 PDB entries)

8. Domain d1a18a_: 1a18 A: [27192]

Details for d1a18a_

PDB Entry: 1a18, 2.4 Å

PDB Description: phenanthroline modified murine adipocyte lipid binding protein

PDB Compounds: (A:) adipocyte lipid binding protein

SCOPe Domain Sequences for d1a18a_:

Sequence; same for both SEQRES and ATOM records:

>d1a18a_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
gvtstrvyera

Timeline for d1a18a_:

• d1a18a_ first appeared (with stable ids) in SCOP 1.55, called d1a18__
  
• d1a18a_ appears in SCOPe 2.05
  
• d1a18a_ appears in SCOPe 2.07
  
• d1a18a_ appears in the current release, SCOPe 2.08