SCOPe 2.06: Domain d4ymsj_: 4yms J:

Lineage for d4ymsj_ (4yms J:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Caldanaerobacter subterraneus [TaxId:273068] [271822] (5 PDB entries)

8. Domain d4ymsj_: 4yms J: [271835]
   automated match to d2oukb_

Details for d4ymsj_

PDB Entry: 4yms, 2.8 Å

PDB Description: crystal structure of an amino acid abc transporter

PDB Compounds: (J:) ABC-type polar amino acid transport system, ATPase component

SCOPe Domain Sequences for d4ymsj_:

Sequence; same for both SEQRES and ATOM records:

>d4ymsj_ c.37.1.0 (J:) automated matches {Caldanaerobacter subterraneus [TaxId: 273068]}
mifvndvyknfgslevlkgvtlkvnkgevvviigpsgsgkstllrcinlleeptkgevfi
dgvkinngkvninkvrqkvgmvfqhfnlfphltaienitlapvkvkkmnkkeaeelavdl
lakvglldkkdqypiklsggqkqrlaiaralamqpevmlfdeptsaldpemvkevlnvmk
qlanegmtmvvvthemgfarevgdrvifmddgviveegtpeeifyraknertreflskil

Timeline for d4ymsj_:

• d4ymsj_ first appeared in SCOPe 2.05
  
• d4ymsj_ appears in SCOPe 2.07
  
• d4ymsj_ appears in the current release, SCOPe 2.08