SCOPe 2.06: Domain d4wv9a1: 4wv9 A:1-207

Lineage for d4wv9a1 (4wv9 A:1-207)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (6 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)

8. Domain d4wv9a1: 4wv9 A:1-207 [271731]
   Other proteins in same PDB: d4wv9a2, d4wv9b2, d4wv9c2, d4wv9d2, d4wv9e2
   automated match to d2wnje_
   complexed with md4

Details for d4wv9a1

PDB Entry: 4wv9, 2 Å

PDB Description: crystal structure of acetylcholine binding protein (achbp) from aplysia californica in complex with click chemistry compound (3-exo)- 8,8-dimethyl-3-[4-(pyridin-4-yl)-1h-1,2,3-triazol-1-yl]-8- azoniabicyclo[3.2.1]octane

PDB Compounds: (A:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d4wv9a1:

Sequence, based on SEQRES records:

>d4wv9a1 b.96.1.0 (A:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrer

Sequence, based on observed residues (ATOM records):

>d4wv9a1 b.96.1.0 (A:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwklns
lmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrls
fmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtrq
vqhysccpepyidvnlvvkfrer

Timeline for d4wv9a1:

• d4wv9a1 first appeared in SCOPe 2.05, called d4wv9a_
  
• d4wv9a1 appears in SCOPe 2.07
  
• d4wv9a1 appears in the current release, SCOPe 2.08