Class a: All alpha proteins [46456] (286 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (30 species) not a true protein |
Species Ralstonia eutropha [TaxId:381666] [271667] (1 PDB entry) |
Domain d4pzec2: 4pze C:186-284 [271672] Other proteins in same PDB: d4pzea1, d4pzeb1, d4pzec1, d4pzed1, d4pzee1, d4pzef1, d4pzeg1, d4pzeh1, d4pzei1 automated match to d4kuga2 complexed with caa |
PDB Entry: 4pze (more details), 2.7 Å
SCOPe Domain Sequences for d4pzec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pzec2 a.100.1.0 (C:186-284) automated matches {Ralstonia eutropha [TaxId: 381666]} gfvvnrilcpmineafcvlgeglaspeeidegmklgcnhpigplaladmigldtmlavme vlytefadpkyrpamlmremvaagylgrktgrgvyvysk
Timeline for d4pzec2: