Lineage for d4cvla3 (4cvl A:320-451)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863129Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 1863130Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) (S)
  5. 1863172Family c.59.1.0: automated matches [254241] (1 protein)
    not a true family
  6. 1863173Protein automated matches [254550] (4 species)
    not a true protein
  7. 1863186Species Pseudomonas aeruginosa [TaxId:208964] [271628] (3 PDB entries)
  8. 1863189Domain d4cvla3: 4cvl A:320-451 [271629]
    Other proteins in same PDB: d4cvla1, d4cvla2
    automated match to d1gg4a1
    complexed with acp, mg

Details for d4cvla3

PDB Entry: 4cvl (more details), 2.98 Å

PDB Description: pamurf in complex with amp-pnp
PDB Compounds: (A:) udp-n-acetylmuramoyl-tripeptide--d-alanyl-d-alanine ligase

SCOPe Domain Sequences for d4cvla3:

Sequence, based on SEQRES records: (download)

>d4cvla3 c.59.1.0 (A:320-451) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
vkgravaqltasglrviddsynanpasmlaaidilsgfsgrtvlvlgdmgelgswaeqah
revgayaagkvsalyavgplmahavqafgatgrhfadqasligalatedptttilikgsr
saamdkvvaalc

Sequence, based on observed residues (ATOM records): (download)

>d4cvla3 c.59.1.0 (A:320-451) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
vkgravaqltasglrviddspasmlaaidilsgfsgrtvlvlgdmgaeqahrevgayaag
kvsalyavgplmahavqafgatgrhfadqasligalatedptttilikgsrsaamdkvva
alc

SCOPe Domain Coordinates for d4cvla3:

Click to download the PDB-style file with coordinates for d4cvla3.
(The format of our PDB-style files is described here.)

Timeline for d4cvla3: