Lineage for d4q5rd1 (4q5r D:2-77)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879211Species Blattella germanica [TaxId:6973] [270993] (1 PDB entry)
  8. 2879215Domain d4q5rd1: 4q5r D:2-77 [271013]
    Other proteins in same PDB: d4q5ra2, d4q5rb2, d4q5rc2, d4q5rd2, d4q5re2, d4q5rf2
    automated match to d3vura1
    complexed with cl, gol, gsh

Details for d4q5rd1

PDB Entry: 4q5r (more details), 2.25 Å

PDB Description: crystal structure of glutathione s-transferase bla g 5
PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d4q5rd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q5rd1 c.47.1.0 (D:2-77) automated matches {Blattella germanica [TaxId: 6973]}
apsykltycpvkalgepirfllsygekdfedyrfqegdwpnlkpsmpfgktpvleidgkq
thqsvaisrylgkqfg

SCOPe Domain Coordinates for d4q5rd1:

Click to download the PDB-style file with coordinates for d4q5rd1.
(The format of our PDB-style files is described here.)

Timeline for d4q5rd1: