Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (71 species) not a true protein |
Species Environmental samples [TaxId:33858] [270859] (1 PDB entry) |
Domain d4xvce_: 4xvc E: [270862] automated match to d3g9ta_ complexed with pms |
PDB Entry: 4xvc (more details), 2 Å
SCOPe Domain Sequences for d4xvce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xvce_ c.69.1.0 (E:) automated matches {Environmental samples [TaxId: 33858]} makspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewi yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea tgesfttnatmdpsvnkervmsiaalylggknpqaplasplyadlqglppllvqvggiet llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig
Timeline for d4xvce_: