Lineage for d4xvce_ (4xvc E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871151Species Environmental samples [TaxId:33858] [270859] (1 PDB entry)
  8. 1871156Domain d4xvce_: 4xvc E: [270862]
    automated match to d3g9ta_
    complexed with pms

Details for d4xvce_

PDB Entry: 4xvc (more details), 2 Å

PDB Description: crystal structure of an esterase from the bacterial hormone-sensitive lipase (hsl) family
PDB Compounds: (E:) Esterase E40

SCOPe Domain Sequences for d4xvce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xvce_ c.69.1.0 (E:) automated matches {Environmental samples [TaxId: 33858]}
makspeldrvigmireraatprkttdddrrlyetmlgsmpldddiqterlgvngvpaewi
yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
tgesfttnatmdpsvnkervmsiaalylggknpqaplasplyadlqglppllvqvggiet
llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig

SCOPe Domain Coordinates for d4xvce_:

Click to download the PDB-style file with coordinates for d4xvce_.
(The format of our PDB-style files is described here.)

Timeline for d4xvce_: