Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (5 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries) |
Domain d4x1yc2: 4x1y C:246-438 [270808] Other proteins in same PDB: d4x1ya1, d4x1yb1, d4x1yc1, d4x1yd1, d4x1ye_ automated match to d4i50a2 complexed with 3wv, gdp, gtp, loc, mg |
PDB Entry: 4x1y (more details), 3.19 Å
SCOPe Domain Sequences for d4x1yc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x1yc2 d.79.2.1 (C:246-438) automated matches {Sheep (Ovis aries) [TaxId: 9940]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvd
Timeline for d4x1yc2: