Lineage for d4r87k_ (4r87 K:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921812Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1921813Protein automated matches [190038] (32 species)
    not a true protein
  7. 1922024Species Vibrio cholerae [TaxId:666] [188612] (12 PDB entries)
  8. 1922090Domain d4r87k_: 4r87 K: [270417]
    automated match to d3eg7b_
    complexed with coa, peg, spm

Details for d4r87k_

PDB Entry: 4r87 (more details), 2.61 Å

PDB Description: crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with coa and spermine
PDB Compounds: (K:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d4r87k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r87k_ d.108.1.0 (K:) automated matches {Vibrio cholerae [TaxId: 666]}
nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnr

SCOPe Domain Coordinates for d4r87k_:

Click to download the PDB-style file with coordinates for d4r87k_.
(The format of our PDB-style files is described here.)

Timeline for d4r87k_: