Lineage for d1a5ud1 (1a5u D:1916-2017)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232326Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 232327Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 232328Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 232329Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 232376Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (6 PDB entries)
  8. 232388Domain d1a5ud1: 1a5u D:1916-2017 [27037]
    Other proteins in same PDB: d1a5ua2, d1a5ua3, d1a5ub2, d1a5ub3, d1a5uc2, d1a5uc3, d1a5ud2, d1a5ud3, d1a5ue2, d1a5ue3, d1a5uf2, d1a5uf3, d1a5ug2, d1a5ug3, d1a5uh2, d1a5uh3

Details for d1a5ud1

PDB Entry: 1a5u (more details), 2.35 Å

PDB Description: pyruvate kinase complex with bis mg-atp-na-oxalate

SCOP Domain Sequences for d1a5ud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5ud1 b.58.1.1 (D:1916-2017) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus)}
peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

SCOP Domain Coordinates for d1a5ud1:

Click to download the PDB-style file with coordinates for d1a5ud1.
(The format of our PDB-style files is described here.)

Timeline for d1a5ud1: