SCOPe 2.05: Domain d2m1kd_: 2m1k D:

Lineage for d2m1kd_ (2m1k D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (35 PDB entries)

8. Domain d2m1kd_: 2m1k D: [270268]
   automated match to d1a03a_

Details for d2m1kd_

PDB Entry: 2m1k

PDB Description: interaction of human s100a6 (c3s) with v domain of receptor for advanced glycation end products (rage)

PDB Compounds: (D:) Protein S100-A6

SCOPe Domain Sequences for d2m1kd_:

Sequence; same for both SEQRES and ATOM records:

>d2m1kd_ a.39.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aspldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedld
rnkdqevnfqeyvtflgalaliynealkg

Timeline for d2m1kd_:

• d2m1kd_ is new in SCOPe 2.05-stable
  
• d2m1kd_ appears in SCOPe 2.06
  
• d2m1kd_ appears in the current release, SCOPe 2.08