Lineage for d4s1ea_ (4s1e A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1801476Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1801477Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1801478Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1801745Protein automated matches [190077] (18 species)
    not a true protein
  7. 1801791Species Leishmania donovani [TaxId:5661] [187796] (4 PDB entries)
  8. 1801794Domain d4s1ea_: 4s1e A: [269889]
    automated match to d2haqa_
    mutant

Details for d4s1ea_

PDB Entry: 4s1e (more details), 2.22 Å

PDB Description: crystal structure of cyclophilin mutant l120a from leishmania donovani at 2.22 angstrom.
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d4s1ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s1ea_ b.62.1.1 (A:) automated matches {Leishmania donovani [TaxId: 5661]}
epevtakvyfdvmidseplgritiglfgkdaplttenfrqlctgehgfgykdsifhrvip
nfmiqggdftnfdgtggksiygekfadenlkvkhfvgaasmanagpntngsqffittapt
pwldgrhvvfgkvldgmdvvlriektktnshdrpvkpvkivasgel

SCOPe Domain Coordinates for d4s1ea_:

Click to download the PDB-style file with coordinates for d4s1ea_.
(The format of our PDB-style files is described here.)

Timeline for d4s1ea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4s1eb_