Class b: All beta proteins [48724] (176 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein automated matches [190077] (18 species) not a true protein |
Species Leishmania donovani [TaxId:5661] [187796] (4 PDB entries) |
Domain d4s1ea_: 4s1e A: [269889] automated match to d2haqa_ mutant |
PDB Entry: 4s1e (more details), 2.22 Å
SCOPe Domain Sequences for d4s1ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4s1ea_ b.62.1.1 (A:) automated matches {Leishmania donovani [TaxId: 5661]} epevtakvyfdvmidseplgritiglfgkdaplttenfrqlctgehgfgykdsifhrvip nfmiqggdftnfdgtggksiygekfadenlkvkhfvgaasmanagpntngsqffittapt pwldgrhvvfgkvldgmdvvlriektktnshdrpvkpvkivasgel
Timeline for d4s1ea_: