SCOP 1.65: Domain d1pls__: 1pls -

Lineage for d1pls__ (1pls -)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (6 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (15 proteins)

6. Protein Pleckstrin, N-terminal domain [50740] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50741] (1 PDB entry)

8. Domain d1pls__: 1pls - [26965]
   mutant

Details for d1pls__

PDB Entry: 1pls

PDB Description: solution structure of a pleckstrin homology domain

SCOP Domain Sequences for d1pls__:

Sequence; same for both SEQRES and ATOM records:

>d1pls__ b.55.1.1 (-) Pleckstrin, N-terminal domain {Human (Homo sapiens)}
mepkriregylvkkgsvfntwkpmwvvlledgiefykkksdnspkgmiplkgstltspcq
dfgkrmfvfkitttkqqdhffqaafleerdawvrdinkaikcieglehhhhhh

Timeline for d1pls__:

• d1pls__ first appeared (with stable ids) in SCOP 1.55
  
• d1pls__ appears in SCOP 1.63
  
• d1pls__ appears in SCOP 1.67
  
• d1pls__ appears in the current release, SCOPe 2.08, called d1plsa1