Lineage for d1pls__ (1pls -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.55: PH domain-like [50728] (1 superfamily) Superfamily b.55.1: PH domain-like [50729] (5 families) 
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (11 proteins) 
Protein Pleckstrin, N-terminal domain [50740] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50741] (1 PDB entry) 
Domain d1pls__: 1pls - [26965]
Details for d1pls__
PDB Entry: 1pls (more details)
PDB Description: solution structure of a pleckstrin homology domain
SCOP Domain Sequences for d1pls__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pls__ b.55.1.1 (-) Pleckstrin, N-terminal domain {Human (Homo sapiens)}
mepkriregylvkkgsvfntwkpmwvvlledgiefykkksdnspkgmiplkgstltspcq
dfgkrmfvfkitttkqqdhffqaafleerdawvrdinkaikcieglehhhhhh
SCOP Domain Coordinates for d1pls__:
Click to download the PDB-style file with coordinates for d1pls__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pls__:
- d1pls__ appears in SCOP 1.57
- d1pls__ appears in the current release, SCOPe 2.08, called d1plsa1
View in 3D