SCOPe 2.05: Domain d3j9sa2: 3j9s A:149-332

Lineage for d3j9sa2 (3j9s A:149-332)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins)
   this domain is inserted into a multihelical domain

6. Protein vp6, the major capsid protein of group A rotavirus [63718] (2 species)

7. Species Bovine rotavirus strain uk/g6 [TaxId:10934] [269641] (1 PDB entry)

8. Domain d3j9sa2: 3j9s A:149-332 [269642]
   Other proteins in same PDB: d3j9sa1
   automated match to d1qhda2
   complexed with ca, cl, zn

Details for d3j9sa2

PDB Entry: 3j9s, 2.6 Å

PDB Description: single particle cryo-em structure of rotavirus vp6 at 2.6 angstrom resolution

PDB Compounds: (A:) Intermediate capsid protein VP6

SCOPe Domain Sequences for d3j9sa2:

Sequence; same for both SEQRES and ATOM records:

>d3j9sa2 b.19.1.1 (A:149-332) vp6, the major capsid protein of group A rotavirus {Bovine rotavirus strain uk/g6 [TaxId: 10934]}
gftfhkpnifpysasftlnrsqpahdnlmgtmwlnagseiqvagfdyscainapantqqf
ehivqlrrvlttatitllpdaerfsfprvitsadgattwyfnpvilrpnnveiefllngq
iintyqarfgtiiarnfdtirlsfqlmrppnmtpavaalfpnaqpfehhatvgltlries
avce

Timeline for d3j9sa2:

• d3j9sa2 is new in SCOPe 2.05-stable
  
• d3j9sa2 appears in SCOPe 2.06
  
• d3j9sa2 appears in the current release, SCOPe 2.08