Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (17 PDB entries) |
Domain d4x6ea1: 4x6e A:7-183 [269547] Other proteins in same PDB: d4x6ea2, d4x6ea3, d4x6eb_ automated match to d3t8xc1 complexed with 42h, mlt |
PDB Entry: 4x6e (more details), 2.1 Å
SCOPe Domain Sequences for d4x6ea1:
Sequence, based on SEQRES records: (download)
>d4x6ea1 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]} plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr
>d4x6ea1 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]} plsfhviwiasfkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkeletlfr irtirsfegirryahelqfeypfeiqvtggcegsflqlayqgsdfvsfqnnswlpypvag nmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr
Timeline for d4x6ea1: