SCOPe 2.05: Domain d4wswb_: 4wsw B:

Lineage for d4wswb_ (4wsw B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (10 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [255657] (7 PDB entries)

8. Domain d4wswb_: 4wsw B: [269518]
   Other proteins in same PDB: d4wswa_, d4wswc_, d4wswe_
   automated match to d4uo4b_
   complexed with nag

Details for d4wswb_

PDB Entry: 4wsw, 2.8 Å

PDB Description: the crystal structure of hemagglutinin from a/green-winged teal/texas/y171/2006 influenza virus

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4wswb_:

Sequence; same for both SEQRES and ATOM records:

>d4wswb_ h.3.1.0 (B:) automated matches {Influenza A virus [TaxId: 11320]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
tefesiesefseiehqigniinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhkcddncmesirnntydhtqyreeallnrln

Timeline for d4wswb_:

• d4wswb_ is new in SCOPe 2.05-stable
  
• d4wswb_ appears in SCOPe 2.06
  
• d4wswb_ appears in the current release, SCOPe 2.08