SCOPe 2.06: Domain d4xfjb2: 4xfj B:173-398

Lineage for d4xfjb2 (4xfj B:173-398)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
   unusual fold

4. Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families)

5. Family d.210.1.0: automated matches [227194] (1 protein)
   not a true family

6. Protein automated matches [226921] (3 species)
   not a true protein

7. Species Mycobacterium thermoresistibile [TaxId:1078020] [260071] (2 PDB entries)

8. Domain d4xfjb2: 4xfj B:173-398 [269196]
   Other proteins in same PDB: d4xfja1, d4xfjb1
   automated match to d4u7ja2
   complexed with anp, arg, edo, mg

Details for d4xfjb2

PDB Entry: 4xfj, 1.55 Å

PDB Description: crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine

PDB Compounds: (B:) argininosuccinate synthase

SCOPe Domain Sequences for d4xfjb2:

Sequence; same for both SEQRES and ATOM records:

>d4xfjb2 d.210.1.0 (B:173-398) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
pfsidqnvwgravetgflehlwnaptkdvysytedptvnwstpdevivgfeqgvpvsidg
rsvtplqaieelnrrggeqgvgrldvvedrlvgiksreiyeapgamvlitahtelehvtl
erelgrfkritdqkwgelvydglwfsplktalesfvaktqehvtgeirmvlhgghiavng
rrspkslydfnlatydegdtfdqsaakgfvqihglsssisarrdlq

Timeline for d4xfjb2:

• d4xfjb2 first appeared in SCOPe 2.05
  
• d4xfjb2 appears in SCOPe 2.07
  
• d4xfjb2 appears in the current release, SCOPe 2.08