Lineage for d4xeqb_ (4xeq B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163734Species Desulfovibrio vulgaris [TaxId:573059] [269191] (1 PDB entry)
  8. 2163736Domain d4xeqb_: 4xeq B: [269192]
    automated match to d4n6ka_
    complexed with paf

Details for d4xeqb_

PDB Entry: 4xeq (more details), 1.7 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
PDB Compounds: (B:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4xeqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xeqb_ c.94.1.0 (B:) automated matches {Desulfovibrio vulgaris [TaxId: 573059]}
aeditlavvtkpgsaqyvcaerfaqllaersdkrfnvvlhhsaslgtetdilqqvqlgav
qmaivttgtldafvpemaaldfpflftdtttadrvldgpvgrglldrlstagfkglhfse
ngfrhltnsirpvmtpddvrglkirvmesqvhrelwrtlganptpmgwpiyaelqqgtld
gqenplwviaeyrlnevqkhlsltghvysthtdlanlawfealpandrrllascmqdaal
wqrtwsrqrdaayleqlrtagmqvierpdiatfrqrvqplsgsalfehkgvrkaledlma
atra

SCOPe Domain Coordinates for d4xeqb_:

Click to download the PDB-style file with coordinates for d4xeqb_.
(The format of our PDB-style files is described here.)

Timeline for d4xeqb_: