Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (26 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:235909] [269096] (3 PDB entries) |
Domain d4wxye_: 4wxy E: [269102] Other proteins in same PDB: d4wxyb_, d4wxyd_, d4wxyf_, d4wxyh_, d4wxyj_, d4wxyl_ automated match to d3fema_ mutant |
PDB Entry: 4wxy (more details), 2.7 Å
SCOPe Domain Sequences for d4wxye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wxye_ c.1.2.0 (E:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} altgtdrvkrgmaemqkggvimdvvnaeqakiaeaagavavmalervpadiraaggvarm adptvieevmnavsipvmaxvrighyvearvlealgvdyidesevltpadeefhidkrqf tvpfvcgcrdlgeaarriaegasmlrtkgepgtgniveavrhmrkvnaqirkvvnmsede lvaeakqlgapvevlreikrlgrlpvvnfaaggvttpadaalmmhlgadgvfvgsgifks enpekyaraiveatthyedyeliahlskglggamrgidiatllpehrmq
Timeline for d4wxye_: