Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
Protein automated matches [191172] (7 species) not a true protein |
Species Escherichia coli [TaxId:562] [256126] (5 PDB entries) |
Domain d4ue3t_: 4ue3 T: [268940] Other proteins in same PDB: d4ue3l_, d4ue3m_ automated match to d3rgws_ complexed with cl, f3s, mg, nfv, sf3, sf4, so4 |
PDB Entry: 4ue3 (more details), 1.4 Å
SCOPe Domain Sequences for d4ue3t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ue3t_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 562]} kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi qsghgclgcaengfwdrgsfysrvv
Timeline for d4ue3t_: