SCOPe 2.06: Domain d4p5ka1: 4p5k A:1-83

Lineage for d4p5ka1 (4p5k A:1-83)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)

8. Domain d4p5ka1: 4p5k A:1-83 [268551]
   Other proteins in same PDB: d4p5ka2, d4p5kd2
   automated match to d1muja2

Details for d4p5ka1

PDB Entry: 4p5k, 2.59 Å

PDB Description: structural basis of chronic beryllium disease: bridging the gap between allergy and autoimmunity

PDB Compounds: (A:) HLA class II histocompatibility antigen, DP alpha 1 chain

SCOPe Domain Sequences for d4p5ka1:

Sequence; same for both SEQRES and ATOM records:

>d4p5ka1 d.19.1.0 (A:1-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
aniailnnnlntliqrsnhtqat

Timeline for d4p5ka1:

• d4p5ka1 first appeared in SCOPe 2.05
  
• d4p5ka1 appears in SCOPe 2.07
  
• d4p5ka1 appears in the current release, SCOPe 2.08