SCOPe 2.06: Domain d5pepa_: 5pep A:

Lineage for d5pepa_ (5pep A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Pepsin(ogen) [50658] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50659] (8 PDB entries)

8. Domain d5pepa_: 5pep A: [26845]

Details for d5pepa_

PDB Entry: 5pep, 2.34 Å

PDB Description: x-ray analyses of aspartic proteases. ii. three-dimensional structure of the hexagonal crystal form of porcine pepsin at 2.3 angstroms resolution

PDB Compounds: (A:) pepsin

SCOPe Domain Sequences for d5pepa_:

Sequence; same for both SEQRES and ATOM records:

>d5pepa_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
sdgemviscssiaslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
lgdvfirqyytvfdrannkvglapva

Timeline for d5pepa_:

• d5pepa_ first appeared (with stable ids) in SCOP 1.55, called d5pep__
  
• d5pepa_ appears in SCOPe 2.05
  
• d5pepa_ appears in SCOPe 2.07
  
• d5pepa_ appears in the current release, SCOPe 2.08