![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (91 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:192222] [268320] (3 PDB entries) |
![]() | Domain d4ly8d_: 4ly8 D: [268333] automated match to d3m5vb_ complexed with act, edo, gol, pg4, pge |
PDB Entry: 4ly8 (more details), 1.7 Å
SCOPe Domain Sequences for d4ly8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ly8d_ c.1.10.0 (D:) automated matches {Campylobacter jejuni [TaxId: 192222]} dkniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrt cieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqglye hykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdllah eprmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindely ninkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf
Timeline for d4ly8d_: