Lineage for d4m19c_ (4m19 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2444781Species Campylobacter jejuni [TaxId:192222] [268320] (3 PDB entries)
  8. 2444788Domain d4m19c_: 4m19 C: [268327]
    automated match to d3m5vb_
    complexed with edo, lys, peg, pg4

Details for d4m19c_

PDB Entry: 4m19 (more details), 2 Å

PDB Description: dihydrodipicolinate synthase from C. jejuni with pyruvate bound to the active site and Lysine bound to allosteric site
PDB Compounds: (C:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d4m19c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m19c_ c.1.10.0 (C:) automated matches {Campylobacter jejuni [TaxId: 192222]}
niiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtci
eiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqglyehy
kaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdllahep
rmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyni
nkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

SCOPe Domain Coordinates for d4m19c_:

Click to download the PDB-style file with coordinates for d4m19c_.
(The format of our PDB-style files is described here.)

Timeline for d4m19c_: