Class b: All beta proteins [48724] (176 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein Streptavidin [50878] (1 species) |
Species Streptomyces avidinii [TaxId:1895] [50879] (124 PDB entries) |
Domain d3wypa_: 3wyp A: [268096] automated match to d1mk5a_ complexed with bso, btn, gol, so4 |
PDB Entry: 3wyp (more details), 1.3 Å
SCOPe Domain Sequences for d3wypa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wypa_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]} agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
Timeline for d3wypa_: