Lineage for d3wnwf_ (3wnw F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317540Species Mouse (Mus musculus) [TaxId:10090] [268023] (2 PDB entries)
  8. 2317547Domain d3wnwf_: 3wnw F: [268039]
    automated match to d3vnxa_
    complexed with fe, gol, k, mg

Details for d3wnwf_

PDB Entry: 3wnw (more details), 2.24 Å

PDB Description: Structure of Mouse H-chain modified ferritin
PDB Compounds: (F:) ferritin heavy chain

SCOPe Domain Sequences for d3wnwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wnwf_ a.25.1.0 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgh

SCOPe Domain Coordinates for d3wnwf_:

Click to download the PDB-style file with coordinates for d3wnwf_.
(The format of our PDB-style files is described here.)

Timeline for d3wnwf_: