Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (58 species) not a true protein |
Species Ulva pertusa [TaxId:3120] [267904] (1 PDB entry) |
Domain d3vnxa_: 3vnx A: [265571] automated match to d3a9qe_ complexed with ca |
PDB Entry: 3vnx (more details), 2.4 Å
SCOPe Domain Sequences for d3vnxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vnxa_ a.25.1.0 (A:) automated matches {Ulva pertusa [TaxId: 3120]} vfqpfsevqgelstvtqapvtdsyarveyhieceaaineqinieytisyvyhalhsyfar dnvglpgfakffkeasdeerehahmlmdyqtkrggrvelkplaapemefanddkgealya melalsleklnfqklqalqaiadkhkdaalcdfveggllseqvdavkehavyvsqlrrvg kgvgvylldqelgee
Timeline for d3vnxa_: