Lineage for d3vnxa_ (3vnx A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2318504Species Ulva pertusa [TaxId:3120] [267904] (1 PDB entry)
  8. 2318505Domain d3vnxa_: 3vnx A: [265571]
    automated match to d3a9qe_
    complexed with ca

Details for d3vnxa_

PDB Entry: 3vnx (more details), 2.4 Å

PDB Description: Crystal structure of ferritin from multicellular green algae, Ulva pertusa.
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d3vnxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vnxa_ a.25.1.0 (A:) automated matches {Ulva pertusa [TaxId: 3120]}
vfqpfsevqgelstvtqapvtdsyarveyhieceaaineqinieytisyvyhalhsyfar
dnvglpgfakffkeasdeerehahmlmdyqtkrggrvelkplaapemefanddkgealya
melalsleklnfqklqalqaiadkhkdaalcdfveggllseqvdavkehavyvsqlrrvg
kgvgvylldqelgee

SCOPe Domain Coordinates for d3vnxa_:

Click to download the PDB-style file with coordinates for d3vnxa_.
(The format of our PDB-style files is described here.)

Timeline for d3vnxa_: