SCOP 1.75: Domain d1tcxb_: 1tcx B:

Lineage for d1tcxb_ (1tcx B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (3 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (16 PDB entries)

8. Domain d1tcxb_: 1tcx B: [26749]
   complexed with im1; mutant

Details for d1tcxb_

PDB Entry: 1tcx, 2.3 Å

PDB Description: hiv triple mutant protease complexed with inhibitor sb203386

PDB Compounds: (B:) hiv protease

SCOP Domain Sequences for d1tcxb_:

Sequence; same for both SEQRES and ATOM records:

>d1tcxb_ b.50.1.1 (B:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]}
pqitlwqrplvtikiggqlkealldtgaddtileemslpgrwkpkmvggiggfikvrqyd
qilieicghkaigtvlvgptpiniigrnlltqigctlnf

Timeline for d1tcxb_:

• d1tcxb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tcxb_ appears in SCOP 1.73
  
• d1tcxb_ appears in SCOPe 2.01
  
• d1tcxb_ appears in the current release, SCOPe 2.08