Class b: All beta proteins [48724] (176 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (2 species) |
Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries) |
Domain d1hsib_: 1hsi B: [26738] |
PDB Entry: 1hsi (more details), 2.5 Å
SCOPe Domain Sequences for d1hsib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hsib_ b.50.1.1 (B:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]} pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk nveievlnkkvratimtgdtpinifgrniltalgmslnl
Timeline for d1hsib_: