Lineage for d3upja_ (3upj A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2067628Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2068848Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (2 species)
  7. 2068856Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries)
  8. 2068873Domain d3upja_: 3upj A: [26735]
    complexed with u03; mutant

Details for d3upja_

PDB Entry: 3upj (more details), 2.5 Å

PDB Description: human immunodeficiency virus type 2 protease mutant with lys 57 replaced by leu (k57l) complex with u096333 [4-hydroxy-3-[1-(phenyl) propyl]-7-methoxycoumarin]
PDB Compounds: (A:) hiv-2 protease

SCOPe Domain Sequences for d3upja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3upja_ b.50.1.1 (A:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

SCOPe Domain Coordinates for d3upja_:

Click to download the PDB-style file with coordinates for d3upja_.
(The format of our PDB-style files is described here.)

Timeline for d3upja_: