SCOPe 2.05: Domain d4qgga_: 4qgg A:

Lineage for d4qgga_ (4qgg A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282458] [193407] (7 PDB entries)

8. Domain d4qgga_: 4qgg A: [267310]
   automated match to d2ccgb_
   complexed with 32c

Details for d4qgga_

PDB Entry: 4qgg, 1.62 Å

PDB Description: tmk in complex with compound 46, 2-(3-chlorophenoxy)-3-fluoro-4-{(1r)-3-methyl-1-[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]butyl}benzoic acid

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d4qgga_:

Sequence, based on SEQRES records:

>d4qgga_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikyleki

Sequence, based on observed residues (ATOM records):

>d4qgga_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgrerdqedlkfhekviegyqeiihnesqrfksvnadqplenvve
dtyqtiikyleki

Timeline for d4qgga_:

• d4qgga_ is new in SCOPe 2.05-stable
  
• d4qgga_ appears in SCOPe 2.06
  
• d4qgga_ appears in the current release, SCOPe 2.08