Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein automated matches [190061] (6 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [259282] (2 PDB entries) |
Domain d4qfib_: 4qfi B: [267307] automated match to d4qfja_ complexed with acy, zn |
PDB Entry: 4qfi (more details), 1.78 Å
SCOPe Domain Sequences for d4qfib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qfib_ d.5.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} dprytkfltqhydakpkgrdarycesmmrrrgltspckevntfihgnkgsikaicgangs pygenlrisqspfqittckhtggsprppcryrasagfrhvviacenglpvhfdesfi
Timeline for d4qfib_: