SCOPe 2.05: Domain d4upja_: 4upj A:

Lineage for d4upja_ (4upj A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (2 species)

7. Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries)

8. Domain d4upja_: 4upj A: [26719]
   complexed with u04; mutant

Details for d4upja_

PDB Entry: 4upj, 1.9 Å

PDB Description: human immunodeficiency virus type 2 protease mutant with lys 57 replaced by leu (k57l) complex with u097410 [4-hydroxy-3-[1-[3- [[[[(tert-butyloxycarbonyl) aminomethyl]carbonyl]amino]phenyl]propyl]coumarin

PDB Compounds: (A:) hiv-2 protease

SCOPe Domain Sequences for d4upja_:

Sequence; same for both SEQRES and ATOM records:

>d4upja_ b.50.1.1 (A:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

Timeline for d4upja_:

• d4upja_ first appeared (with stable ids) in SCOP 1.55
  
• d4upja_ appears in SCOPe 2.04
  
• d4upja_ appears in SCOPe 2.06
  
• d4upja_ appears in the current release, SCOPe 2.08