Lineage for d4mwca1 (4mwc A:238-606)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841999Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1842000Protein automated matches [190459] (41 species)
    not a true protein
  7. 1842218Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188998] (16 PDB entries)
  8. 1842247Domain d4mwca1: 4mwc A:238-606 [266825]
    Other proteins in same PDB: d4mwca2, d4mwcb2
    automated match to d4mvyb2
    protein/RNA complex; complexed with 2em, dms, gol, met, so4

Details for d4mwca1

PDB Entry: 4mwc (more details), 2.65 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-(3-{[(2-methyl-1-benzothiophen-3-yl)methyl]amino}propyl)-3-thiophen-3-ylurea (Chem 1540)
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mwca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mwca1 c.26.1.0 (A:238-606) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa
kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg
ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll
ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda
ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp
lpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdkn
miarlngel

SCOPe Domain Coordinates for d4mwca1:

Click to download the PDB-style file with coordinates for d4mwca1.
(The format of our PDB-style files is described here.)

Timeline for d4mwca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mwca2