Lineage for d4m5ka_ (4m5k A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954945Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) (S)
    common fold is elaborated with additional secondary structures
    automatically mapped to Pfam PF01288
  5. 2954946Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)
  6. 2954947Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species)
  7. 2954948Species Escherichia coli K-12 [TaxId:83333] [189336] (12 PDB entries)
  8. 2954955Domain d4m5ka_: 4m5k A: [266716]
    automated match to d4m5ha_
    complexed with apc, ca, gol, yh3

Details for d4m5ka_

PDB Entry: 4m5k (more details), 1.3 Å

PDB Description: The Identification, Analysis and Structure-Based Development of Novel Inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
PDB Compounds: (A:) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

SCOPe Domain Sequences for d4m5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m5ka_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli K-12 [TaxId: 83333]}
mtvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaava
letslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmk
nrgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

SCOPe Domain Coordinates for d4m5ka_:

Click to download the PDB-style file with coordinates for d4m5ka_.
(The format of our PDB-style files is described here.)

Timeline for d4m5ka_: