Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) common fold is elaborated with additional secondary structures automatically mapped to Pfam PF01288 |
Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein) |
Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species) |
Species Escherichia coli K-12 [TaxId:83333] [189336] (12 PDB entries) |
Domain d4m5ia_: 4m5i A: [266714] automated match to d4m5ha_ complexed with apc, ca, cl, yh6 |
PDB Entry: 4m5i (more details), 1.08 Å
SCOPe Domain Sequences for d4m5ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m5ia_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli K-12 [TaxId: 83333]} mtvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaava letslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmk nrgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw
Timeline for d4m5ia_: