Lineage for d4k7oa_ (4k7o A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854913Species Human (Homo sapiens) [TaxId:9606] [188013] (102 PDB entries)
  8. 1855066Domain d4k7oa_: 4k7o A: [266535]
    automated match to d3umac_
    complexed with dms, ekz

Details for d4k7oa_

PDB Entry: 4k7o (more details), 1.98 Å

PDB Description: human peroxiredoxin 5 with a fragment
PDB Compounds: (A:) Peroxiredoxin-5, mitochondrial

SCOPe Domain Sequences for d4k7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k7oa_ c.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sapikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqa
ealkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsi
fgnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql

SCOPe Domain Coordinates for d4k7oa_:

Click to download the PDB-style file with coordinates for d4k7oa_.
(The format of our PDB-style files is described here.)

Timeline for d4k7oa_: