Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
Protein Mandelate racemase [54838] (3 species) |
Species Dickeya dadantii [TaxId:579405] [267742] (1 PDB entry) |
Domain d4ihcd1: 4ihc D:3-116 [266417] Other proteins in same PDB: d4ihca2, d4ihcb2, d4ihcc2, d4ihcd2, d4ihce2, d4ihcf2, d4ihcg2, d4ihch2 complexed with cl, fmt, gol, iod, mg |
PDB Entry: 4ihc (more details), 2 Å
SCOPe Domain Sequences for d4ihcd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ihcd1 d.54.1.1 (D:3-116) Mandelate racemase {Dickeya dadantii [TaxId: 579405]} klkitnvktiltapggidlavvkvetnepglyglgcatftqrifavksaideymapflig kdptriediwqsaavsgywrngpimnnalsgvdmalwdikgklagmpvyellgg
Timeline for d4ihcd1: