Lineage for d4gird1 (4gir D:1-115)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555551Species Vibrio harveyi [TaxId:673519] [267936] (3 PDB entries)
  8. 2555559Domain d4gird1: 4gir D:1-115 [266316]
    Other proteins in same PDB: d4gira2, d4girb2, d4girb3, d4girc2, d4gird2, d4gird3
    automated match to d4ihca1
    complexed with cl, edo, mg, na, so4

Details for d4gird1

PDB Entry: 4gir (more details), 2 Å

PDB Description: Crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, ethylene glycol and sulfate bound (ordered loops, space group P41212)
PDB Compounds: (D:) enolase

SCOPe Domain Sequences for d4gird1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gird1 d.54.1.0 (D:1-115) automated matches {Vibrio harveyi [TaxId: 673519]}
mnkntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdeylkplli
gkdanniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfgg

SCOPe Domain Coordinates for d4gird1:

Click to download the PDB-style file with coordinates for d4gird1.
(The format of our PDB-style files is described here.)

Timeline for d4gird1: