Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Vibrio harveyi [TaxId:673519] [267936] (3 PDB entries) |
Domain d4girb1: 4gir B:1-115 [266312] Other proteins in same PDB: d4gira2, d4girb2, d4girb3, d4girc2, d4gird2, d4gird3 automated match to d4ihca1 complexed with cl, edo, mg, na, so4 |
PDB Entry: 4gir (more details), 2 Å
SCOPe Domain Sequences for d4girb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4girb1 d.54.1.0 (B:1-115) automated matches {Vibrio harveyi [TaxId: 673519]} mnkntisniecvitkpdrhnlitvivetesgvtgygcatfqqrplavktmvdeylkplli gkdanniedlwqmmmvnaywrngpvinnaisgvdmalwdikakianmplhqlfgg
Timeline for d4girb1: