SCOPe 2.08: Domain d4eo4b2: 4eo4 B:341-462

Lineage for d4eo4b2 (4eo4 B:341-462)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.0: automated matches [227929] (1 protein)
   not a true family

6. Protein automated matches [227930] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267893] (3 PDB entries)

8. Domain d4eo4b2: 4eo4 B:341-462 [266226]
   Other proteins in same PDB: d4eo4a1, d4eo4b1, d4eo4c1, d4eo4d1
   automated match to d4hwta2
   protein/RNA complex; complexed with ssa, zn

Details for d4eo4b2

PDB Entry: 4eo4, 2.87 Å

PDB Description: Crystal structure of the yeast mitochondrial threonyl-tRNA synthetase (MST1) in complex with seryl sulfamoyl adenylate

PDB Compounds: (B:) Threonine--tRNA ligase, mitochondrial

SCOPe Domain Sequences for d4eo4b2:

Sequence; same for both SEQRES and ATOM records:

>d4eo4b2 c.51.1.0 (B:341-462) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
wpfwlnpyqaviipvntknvqqldmctalqkklrneleaddmepvplndwhfnvdldirn
epvgyriksailknysyliivgdeevqlqkynirerdnrksfekltmsqiwekfielekn
yk

Timeline for d4eo4b2:

• d4eo4b2 first appeared in SCOPe 2.05
  
• d4eo4b2 appears in SCOPe 2.07