Lineage for d4ei2e2 (4ei2 E:245-337)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1947194Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 1947195Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) (S)
  5. 1947226Family d.286.1.0: automated matches [228502] (1 protein)
    not a true family
  6. 1947227Protein automated matches [228504] (1 species)
    not a true protein
  7. 1947228Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries)
  8. 1947257Domain d4ei2e2: 4ei2 E:245-337 [266200]
    Other proteins in same PDB: d4ei2a1, d4ei2b1, d4ei2c1, d4ei2d1, d4ei2e1, d4ei2f1, d4ei2g1, d4ei2h1, d4ei2i1, d4ei2j1, d4ei2k1, d4ei2l1, d4ei2m1, d4ei2n1, d4ei2o1, d4ei2p1
    automated match to d2aema2
    complexed with ba

Details for d4ei2e2

PDB Entry: 4ei2 (more details), 3.11 Å

PDB Description: Crystal Structures of MthK RCK gating ring bound to Barium
PDB Compounds: (E:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4ei2e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ei2e2 d.286.1.0 (E:245-337) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisal

SCOPe Domain Coordinates for d4ei2e2:

Click to download the PDB-style file with coordinates for d4ei2e2.
(The format of our PDB-style files is described here.)

Timeline for d4ei2e2: