SCOPe 2.07: Domain d4cz5c1: 4cz5 C:302-331

Lineage for d4cz5c1 (4cz5 C:302-331)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
   core: 4 helices; bundle

4. Superfamily a.53.1: p53 tetramerization domain [47719] (2 families)
   homotetramer

5. Family a.53.1.0: automated matches [259188] (1 protein)
   not a true family

6. Protein automated matches [259190] (2 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [259192] (5 PDB entries)

8. Domain d4cz5c1: 4cz5 C:302-331 [266114]
   Other proteins in same PDB: d4cz5c2
   automated match to d4cz7b_

Details for d4cz5c1

PDB Entry: 4cz5, 1.02 Å

PDB Description: truncated tetramerization domain of zebrafish p53 (crystal form i)

PDB Compounds: (C:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4cz5c1:

Sequence; same for both SEQRES and ATOM records:

>d4cz5c1 a.53.1.0 (C:302-331) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
eeiftlqvrgreryeilkklndslelsdvv

Timeline for d4cz5c1:

• d4cz5c1 first appeared in SCOPe 2.05, called d4cz5c_
  
• d4cz5c1 appears in SCOPe 2.06
  
• d4cz5c1 appears in the current release, SCOPe 2.08