PDB entry 4cz5

View 4cz5 on RCSB PDB site
Description: Truncated tetramerization domain of zebrafish p53 (crystal form I)
Class: cell cycle
Keywords: cell cycle, p53 family, tumor suppressor, transcription factor, protein evolution
Deposited on 2014-04-16, released 2014-08-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: 0.15866
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cz5a_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cz5b_
  • Chain 'C':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G1K2L5 (3-32)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d4cz5c1, d4cz5c2
  • Chain 'D':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4cz5d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4cz5A (A:)
ggseeiftlqvrgreryeilkklndslelsdvv

    Sequence, based on observed residues (ATOM records): (download) 
    >4cz5A (A:)
eiftlqvrgreryeilkklndslelsdvv

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4cz5B (B:)
ggseeiftlqvrgreryeilkklndslelsdvv

    Sequence, based on observed residues (ATOM records): (download) 
    >4cz5B (B:)
eiftlqvrgreryeilkklndslelsdv

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4cz5C (C:)
ggseeiftlqvrgreryeilkklndslelsdvv

    Sequence, based on observed residues (ATOM records): (download) 
    >4cz5C (C:)
gseeiftlqvrgreryeilkklndslelsdvv

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >4cz5D (D:)
ggseeiftlqvrgreryeilkklndslelsdvv

    Sequence, based on observed residues (ATOM records): (download) 
    >4cz5D (D:)
eiftlqvrgreryeilkklndslelsdvv