Lineage for d1ebkd_ (1ebk D:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 299835Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 299836Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 299837Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 299853Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 299854Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (152 PDB entries)
  8. 300028Domain d1ebkd_: 1ebk D: [26611]

Details for d1ebkd_

PDB Entry: 1ebk (more details), 2.06 Å

PDB Description: structural and kinetic analysis of drug resistant mutants of hiv-1 protease

SCOP Domain Sequences for d1ebkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebkd_ b.50.1.1 (D:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkqplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOP Domain Coordinates for d1ebkd_:

Click to download the PDB-style file with coordinates for d1ebkd_.
(The format of our PDB-style files is described here.)

Timeline for d1ebkd_: